PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g094080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 243aa    MW: 28610.8 Da    PI: 5.1438
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g094080.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.5e-183485556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     +f++eq++ Le+ Fe++  +  +++ + A++lgL+ rqV +WFqN+Ra++k
  Csa05g094080.1 34 KRFSEEQIKSLERIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 85
                    68*************************************************9 PP

2HD-ZIP_I/II120.96.7e-3932123293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +++r+s+eq+k+LE+ Fe+e++Lep++Kv++areLglqprqva+WFqn+RAR+ktkqlEkdy+ L+++y++l+++ e ++ke+++L +el++
  Csa05g094080.1  32 NQKRFSEEQIKSLERIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKDYNILRASYNNLASQFEIMKKEKQALVSELER 123
                     589************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.82E-171689IPR009057Homeodomain-like
SMARTSM003891.4E-132491IPR001356Homeobox domain
PROSITE profilePS5007117.0062787IPR001356Homeobox domain
CDDcd000863.42E-133388No hitNo description
PfamPF000462.6E-153485IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.5E-183494IPR009057Homeodomain-like
PRINTSPR000312.8E-55867IPR000047Helix-turn-helix motif
PROSITE patternPS0002706285IPR017970Homeobox, conserved site
PRINTSPR000312.8E-56783IPR000047Helix-turn-helix motif
PfamPF021836.4E-1687127IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEEGDFFNCC FSETNSGMTM MMNKKKMKKS YNQKRFSEEQ IKSLERIFES ETRLEPRKKV  60
QVARELGLQP RQVAIWFQNK RARWKTKQLE KDYNILRASY NNLASQFEIM KKEKQALVSE  120
LERLKNEEIH KPKEERDHEC CGEQGVALSS STESHNGKCE PEVRLINQGI VLCNDDDGDN  180
NNIKTEYFRF EEETDHHHEL MNIVEQPDDS CLTSSDNWGG FNSDSLLDQS SSNYHNWWEF  240
WT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0598280.0AY059828.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (F21F14.6) mRNA, complete cds.
GenBankAY0871870.0AY087187.1 Arabidopsis thaliana clone 32615 mRNA, complete sequence.
GenBankBT0022060.0BT002206.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (At3g61890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010512567.10.0PREDICTED: homeobox-leucine zipper protein ATHB-12-like
SwissprotQ9M2761e-124ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12
TrEMBLR0H5X01e-134R0H5X0_9BRAS; Uncharacterized protein
STRINGBra014417.1-P1e-124(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.11e-121homeobox 12